PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA751G00001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family NF-YB
Protein Properties Length: 240aa    MW: 26495.7 Da    PI: 7.234
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA751G00001genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB174.61e-5460156197
        NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  vreqdrf+Pianv+rim+++lPa+akis+d+ket+qecvse+isf+t+ea+++cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yrelege+
  AA751G00001  60 VREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTMYLHRYRELEGER 156
                  69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.0E-5056157IPR009072Histone-fold
SuperFamilySSF471132.01E-3763158IPR009072Histone-fold
PfamPF008089.9E-2566130IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.7E-1794112No hitNo description
PROSITE patternPS00685097113IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.7E-17113131No hitNo description
PRINTSPR006158.7E-17132150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MERGGFHGYR KLTLNTTNPS GPGLPAKLFM GEANMQLSEF NQHNRTALVS TNGGEEECTV  60
REQDRFMPIA NVIRIMRRIL PAHAKISDDS KETIQECVSE YISFITGEAN ERCQREQRKT  120
ITAEDVLWAM SKLGFDDYIE PLTMYLHRYR ELEGERGGSC GGGSVSMLSS LVVKRANGTM  180
AEYGGYGAGS GPGIHMAQYH YRHQNGFGYN GNEVNSKIGG SSTAASGGRV EVLPSQQHKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-3959151193NF-YB
4awl_B4e-3959151294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3959151294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199578.21e-136nuclear transcription factor Y subunit B-6
SwissprotQ84W661e-138NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A078FT611e-136A0A078FT61_BRANA; BnaA06g35340D protein
TrEMBLM4E8181e-136M4E818_BRARP; Uncharacterized protein
STRINGBra024924.1-P1e-135(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM98962636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.11e-114nuclear factor Y, subunit B6